PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0043s0520.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 339aa    MW: 38292.9 Da    PI: 4.7346
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0043s0520.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.94.1e-09267317454
                             -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             R ++++   e+Le+++++++ p+ +++  + + ++L+ ++V  WF  +Ra 
  SapurV1A.0043s0520.1.p 267 RKRLKRVHAETLERVYRRTKRPTNTMISSIVHVTNLPRKRVVKWFEDKRAE 317
                             777888899****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.491261321IPR001356Homeobox domain
SuperFamilySSF466892.17E-8263319IPR009057Homeodomain-like
SMARTSM003894.7E-4263325IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-7267318IPR009057Homeodomain-like
CDDcd000863.05E-6267316No hitNo description
PfamPF000469.4E-7267317IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MAFALSSSSA STAFQSLTSL HSSDRLHMRP SSLLLSRHFL ATSTLAFSRR RNHNSTVTSS  60
SKKKKKSVSK KEVREEDDID EDAFEALFGM LEEDLKSDDL SMGDGDDEDG DLSEKDLEKL  120
QRELEEALGV GGDDDDEVEM ISSVGYDVED DDGEDEEEEE RPEMIKNWQL RRLARVLKIG  180
RRKTGIKSLA AELCLDRAVV LDLLRDPPPN LVMMSAALPD EPAPSVVMPE TKPSDIVFEE  240
TTDENVVKSE SEMKLPVHVM QDSWFARKRL KRVHAETLER VYRRTKRPTN TMISSIVHVT  300
NLPRKRVVKW FEDKRAEEGV PDNRNPFQRS VPETVSSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14865RRRNHNSTVTSSSKKKKK
26170KKKKKSVSKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308655.20.0hypothetical protein POPTR_0006s26790g
SwissprotQ8H0V51e-68OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLB9HA310.0B9HA31_POPTR; Uncharacterized protein
STRINGPOPTR_0006s26790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101813138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.12e-55overexpressor of cationic peroxidase 3